PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G26960.1
Common NameAtMYB81, MYB81
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 427aa    MW: 48219.8 Da    PI: 6.3234
Description myb domain protein 81
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G26960.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-162269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed ll+ +v ++G g+W+++ +  g+ R++k+c++rw ++l
      AT2G26960.1 22 KGPWTQAEDNLLIAYVDKHGDGNWNAVQNNSGLSRCGKSCRLRWVNHL 69
                     79*******************************************996 PP

2Myb_DNA-binding482.9e-1575118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+ E+++ ++++++lG++ W++ a++++ gRt++++k++w++
      AT2G26960.1  75 KGAFTEKEEKRVIELHALLGNK-WARMAEELP-GRTDNEIKNFWNT 118
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5371769IPR017930Myb domain
SuperFamilySSF466892.9E-2820116IPR009057Homeodomain-like
SMARTSM007173.7E-142171IPR001005SANT/Myb domain
PfamPF002492.7E-152269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-222376IPR009057Homeodomain-like
CDDcd001672.98E-112469No hitNo description
PROSITE profilePS5129424.51470124IPR017930Myb domain
SMARTSM007171.2E-1474122IPR001005SANT/Myb domain
PfamPF002491.9E-1475118IPR001005SANT/Myb domain
CDDcd001671.06E-1077120No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2377122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MGKVRQDSGS DDDNSIKKSF TKGPWTQAED NLLIAYVDKH GDGNWNAVQN NSGLSRCGKS  60
CRLRWVNHLR PDLKKGAFTE KEEKRVIELH ALLGNKWARM AEELPGRTDN EIKNFWNTRL  120
KRLQRLGLPV YPDEVREHAM NAATHSGLNT DSLDGHHSQE YMEADTVEIP EVDFEHLPLN  180
RSSSYYQSML RHVPPTNVFV RQKPCFFQPP NVYNLIPPSP YMSTGKRPRE PETAFPCPGG  240
YTMNEQSPRL WNYPFVENVS EQLPDSHLLG NAAYSSPPGP LVHGVENFEF PSFQYHEEPG  300
GWGADQPNPM PEHESDNTLV QSPLTAQTPS DCPSSSLYDG LLESVVYGSS GEKPATDTDS  360
ESSLFQSFTP ANENITGKTC FLTLYALHAL HCLCNQFKKS PLLHLHDKLN WCNKFRFNSF  420
KSGTHIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29201225106B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453603690.0
Genevisible266301_at0.0
Expression AtlasAT2G26960-
AtGenExpressAT2G26960-
ATTED-IIAT2G26960-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00279DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G26960.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G26960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4465710.0DQ446571.1 Arabidopsis thaliana clone pENTR221-At2g26960 myb family transcription factor (At2g26960) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180264.10.0myb domain protein 81
SwissprotQ9SM271e-120MY104_ARATH; Transcription factor MYB104
TrEMBLQ9SLH10.0Q9SLH1_ARATH; MYB family transcription factor
STRINGAT2G26960.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91982138
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Achard P,Herr A,Baulcombe DC,Harberd NP
    Modulation of floral development by a gibberellin-regulated microRNA.
    Development, 2004. 131(14): p. 3357-65
    [PMID:15226253]